Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-istR/SymE(toxin) |
Location | 4284709..4285121 | Replicon | chromosome |
Accession | NZ_CP098197 | ||
Organism | Escherichia coli strain Z0117EC0062 |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | NBY21_RS20425 | Protein ID | WP_000132601.1 |
Coordinates | 4284780..4285121 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | istR | ||
Locus tag | - | ||
Coordinates | 4284709..4284785 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY21_RS20415 (4281572) | 4281572..4283161 | + | 1590 | WP_001063200.1 | type I restriction-modification system methyltransferase | - |
NBY21_RS20420 (4283158) | 4283158..4284552 | + | 1395 | WP_001272445.1 | type I restriction-modification system specificity subunit | - |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_10 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4284709) | 4284709..4284785 | - | 77 | NuclAT_9 | - | Antitoxin |
NBY21_RS20425 (4284780) | 4284780..4285121 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
NBY21_RS20430 (4285283) | 4285283..4286662 | + | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
NBY21_RS20435 (4286662) | 4286662..4287708 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T246981 WP_000132601.1 NZ_CP098197:4284780-4285121 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT246981 NZ_CP098197:c4284785-4284709 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|