Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 677405..678204 | Replicon | chromosome |
| Accession | NZ_CP098197 | ||
| Organism | Escherichia coli strain Z0117EC0062 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | NBY21_RS03340 | Protein ID | WP_000347270.1 |
| Coordinates | 677405..677869 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
| Locus tag | NBY21_RS03345 | Protein ID | WP_001551693.1 |
| Coordinates | 677869..678204 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY21_RS03310 (672406) | 672406..672840 | - | 435 | WP_000948837.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| NBY21_RS03315 (672858) | 672858..673736 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NBY21_RS03320 (673726) | 673726..674505 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NBY21_RS03325 (674516) | 674516..674989 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NBY21_RS03330 (675012) | 675012..676292 | - | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NBY21_RS03335 (676541) | 676541..677350 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NBY21_RS03340 (677405) | 677405..677869 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NBY21_RS03345 (677869) | 677869..678204 | - | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NBY21_RS03350 (678353) | 678353..679924 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| NBY21_RS03355 (680299) | 680299..681633 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NBY21_RS03360 (681649) | 681649..682419 | + | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T246965 WP_000347270.1 NZ_CP098197:c677869-677405 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NQ90 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9H1L4 |