Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 82287..82551 | Replicon | plasmid pZ0117EC0098-1 |
| Accession | NZ_CP098196 | ||
| Organism | Escherichia coli strain Z0117EC0098 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | NBY23_RS24950 | Protein ID | WP_001303307.1 |
| Coordinates | 82399..82551 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 82287..82349 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY23_RS24935 (78389) | 78389..79459 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| NBY23_RS24940 (79478) | 79478..80686 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (80866) | 80866..80926 | - | 61 | NuclAT_1 | - | - |
| - (80866) | 80866..80926 | - | 61 | NuclAT_1 | - | - |
| - (80866) | 80866..80926 | - | 61 | NuclAT_1 | - | - |
| - (80866) | 80866..80926 | - | 61 | NuclAT_1 | - | - |
| NBY23_RS24945 (80993) | 80993..81772 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (82287) | 82287..82349 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (82287) | 82287..82349 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (82287) | 82287..82349 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (82287) | 82287..82349 | - | 63 | NuclAT_0 | - | Antitoxin |
| NBY23_RS24950 (82399) | 82399..82551 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| NBY23_RS24955 (82623) | 82623..82874 | - | 252 | WP_001291968.1 | hypothetical protein | - |
| - (83261) | 83261..83312 | - | 52 | NuclAT_2 | - | - |
| - (83261) | 83261..83312 | - | 52 | NuclAT_2 | - | - |
| - (83261) | 83261..83312 | - | 52 | NuclAT_2 | - | - |
| - (83261) | 83261..83312 | - | 52 | NuclAT_2 | - | - |
| NBY23_RS24960 (83863) | 83863..85032 | + | 1170 | Protein_96 | IS3-like element ISEc52 family transposase | - |
| NBY23_RS24965 (85051) | 85051..85227 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| NBY23_RS24970 (85436) | 85436..85645 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| NBY23_RS24975 (85743) | 85743..86357 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaLAP-2 / qnrS1 / aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-14 | - | 1..114575 | 114575 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T246960 WP_001303307.1 NZ_CP098196:82399-82551 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT246960 NZ_CP098196:c82349-82287 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
