Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4875077..4875679 | Replicon | chromosome |
| Accession | NZ_CP098195 | ||
| Organism | Escherichia coli strain Z0117EC0098 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NBY23_RS23720 | Protein ID | WP_000897305.1 |
| Coordinates | 4875368..4875679 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBY23_RS23715 | Protein ID | WP_000356397.1 |
| Coordinates | 4875077..4875367 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY23_RS23690 (4871002) | 4871002..4871904 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NBY23_RS23695 (4871901) | 4871901..4872536 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NBY23_RS23700 (4872533) | 4872533..4873462 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| NBY23_RS23705 (4873792) | 4873792..4874034 | - | 243 | WP_001087409.1 | protein YiiF | - |
| NBY23_RS23710 (4874254) | 4874254..4874472 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| NBY23_RS23715 (4875077) | 4875077..4875367 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NBY23_RS23720 (4875368) | 4875368..4875679 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NBY23_RS23725 (4875908) | 4875908..4876816 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| NBY23_RS23730 (4876880) | 4876880..4877821 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NBY23_RS23735 (4877866) | 4877866..4878303 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| NBY23_RS23740 (4878300) | 4878300..4879172 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| NBY23_RS23745 (4879166) | 4879166..4879765 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| NBY23_RS23750 (4879864) | 4879864..4880649 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T246959 WP_000897305.1 NZ_CP098195:c4875679-4875368 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|