Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2356967..2357338 | Replicon | chromosome |
Accession | NZ_CP098195 | ||
Organism | Escherichia coli strain Z0117EC0098 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | NBY23_RS11795 | Protein ID | WP_001317028.1 |
Coordinates | 2357144..2357338 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2356967..2357145 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY23_RS25160 (2352719) | 2352719..2352892 | + | 174 | WP_001296046.1 | protein YnaL | - |
NBY23_RS11770 (2352922) | 2352922..2354295 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
NBY23_RS11775 (2354424) | 2354424..2355359 | - | 936 | WP_001153728.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NBY23_RS11780 (2355411) | 2355411..2356646 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
NBY23_RS11785 (2356648) | 2356648..2356863 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2356967) | 2356967..2357145 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2356967) | 2356967..2357145 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2356967) | 2356967..2357145 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2356967) | 2356967..2357145 | + | 179 | NuclAT_0 | - | Antitoxin |
NBY23_RS11790 (2356942) | 2356942..2357151 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
NBY23_RS11795 (2357144) | 2357144..2357338 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NBY23_RS11800 (2357395) | 2357395..2358204 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
NBY23_RS11805 (2358197) | 2358197..2360797 | - | 2601 | WP_001532611.1 | exodeoxyribonuclease VIII | - |
NBY23_RS11810 (2360899) | 2360899..2361174 | - | 276 | WP_000632297.1 | protein RacC | - |
NBY23_RS11815 (2361249) | 2361249..2361419 | - | 171 | WP_001352098.1 | YdaE family protein | - |
NBY23_RS11820 (2361419) | 2361419..2361640 | - | 222 | WP_000560225.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2355411..2365934 | 10523 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T246944 WP_001317028.1 NZ_CP098195:c2357338-2357144 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT246944 NZ_CP098195:2356967-2357145 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|