Detailed information of TA system TA246943

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2219736..2219956
• Replicon: chromosome
• Accession: NZ_CP098195
• Organism: Escherichia coli strain Z0117EC0098

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A8S7XT81
• Locus tag: NBY23_RS11090
• Protein ID: WP_074147554.1
• Coordinates: 2219736..2219843 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2219890..2219956 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NBY23_RS11060	2215591..2216424	+	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-
NBY23_RS11065	2216421..2216813	+	393	WP_000200378.1	invasion regulator SirB2	-
NBY23_RS11070	2216817..2217626	+	810	WP_001257044.1	invasion regulator SirB1	-
NBY23_RS11075	2217662..2218516	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
NBY23_RS11080	2218665..2218772	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2218820..2218886	+	67	NuclAT_45	-	-
-	2218820..2218886	+	67	NuclAT_45	-	-
-	2218820..2218886	+	67	NuclAT_45	-	-
-	2218820..2218886	+	67	NuclAT_45	-	-
-	2218820..2218886	+	67	NuclAT_48	-	-
-	2218820..2218886	+	67	NuclAT_48	-	-
-	2218820..2218886	+	67	NuclAT_48	-	-
-	2218820..2218886	+	67	NuclAT_48	-	-
-	2218822..2218885	+	64	NuclAT_17	-	-
-	2218822..2218885	+	64	NuclAT_17	-	-
-	2218822..2218885	+	64	NuclAT_17	-	-
-	2218822..2218885	+	64	NuclAT_17	-	-
-	2218822..2218885	+	64	NuclAT_20	-	-
-	2218822..2218885	+	64	NuclAT_20	-	-
-	2218822..2218885	+	64	NuclAT_20	-	-
-	2218822..2218885	+	64	NuclAT_20	-	-
-	2218822..2218885	+	64	NuclAT_23	-	-
-	2218822..2218885	+	64	NuclAT_23	-	-
-	2218822..2218885	+	64	NuclAT_23	-	-
-	2218822..2218885	+	64	NuclAT_23	-	-
-	2218822..2218885	+	64	NuclAT_26	-	-
-	2218822..2218885	+	64	NuclAT_26	-	-
-	2218822..2218885	+	64	NuclAT_26	-	-
-	2218822..2218885	+	64	NuclAT_26	-	-
-	2218822..2218885	+	64	NuclAT_29	-	-
-	2218822..2218885	+	64	NuclAT_29	-	-
-	2218822..2218885	+	64	NuclAT_29	-	-
-	2218822..2218885	+	64	NuclAT_29	-	-
-	2218822..2218885	+	64	NuclAT_32	-	-
-	2218822..2218885	+	64	NuclAT_32	-	-
-	2218822..2218885	+	64	NuclAT_32	-	-
-	2218822..2218885	+	64	NuclAT_32	-	-
NBY23_RS11085	2219200..2219307	-	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2219360..2219421	+	62	NuclAT_16	-	-
-	2219360..2219421	+	62	NuclAT_16	-	-
-	2219360..2219421	+	62	NuclAT_16	-	-
-	2219360..2219421	+	62	NuclAT_16	-	-
-	2219360..2219421	+	62	NuclAT_19	-	-
-	2219360..2219421	+	62	NuclAT_19	-	-
-	2219360..2219421	+	62	NuclAT_19	-	-
-	2219360..2219421	+	62	NuclAT_19	-	-
-	2219360..2219421	+	62	NuclAT_22	-	-
-	2219360..2219421	+	62	NuclAT_22	-	-
-	2219360..2219421	+	62	NuclAT_22	-	-
-	2219360..2219421	+	62	NuclAT_22	-	-
-	2219360..2219421	+	62	NuclAT_25	-	-
-	2219360..2219421	+	62	NuclAT_25	-	-
-	2219360..2219421	+	62	NuclAT_25	-	-
-	2219360..2219421	+	62	NuclAT_25	-	-
-	2219360..2219421	+	62	NuclAT_28	-	-
-	2219360..2219421	+	62	NuclAT_28	-	-
-	2219360..2219421	+	62	NuclAT_28	-	-
-	2219360..2219421	+	62	NuclAT_28	-	-
-	2219360..2219421	+	62	NuclAT_31	-	-
-	2219360..2219421	+	62	NuclAT_31	-	-
-	2219360..2219421	+	62	NuclAT_31	-	-
-	2219360..2219421	+	62	NuclAT_31	-	-
-	2219360..2219422	+	63	NuclAT_46	-	-
-	2219360..2219422	+	63	NuclAT_46	-	-
-	2219360..2219422	+	63	NuclAT_46	-	-
-	2219360..2219422	+	63	NuclAT_46	-	-
-	2219360..2219422	+	63	NuclAT_49	-	-
-	2219360..2219422	+	63	NuclAT_49	-	-
-	2219360..2219422	+	63	NuclAT_49	-	-
-	2219360..2219422	+	63	NuclAT_49	-	-
-	2219360..2219423	+	64	NuclAT_34	-	-
-	2219360..2219423	+	64	NuclAT_34	-	-
-	2219360..2219423	+	64	NuclAT_34	-	-
-	2219360..2219423	+	64	NuclAT_34	-	-
-	2219360..2219423	+	64	NuclAT_36	-	-
-	2219360..2219423	+	64	NuclAT_36	-	-
-	2219360..2219423	+	64	NuclAT_36	-	-
-	2219360..2219423	+	64	NuclAT_36	-	-
-	2219360..2219423	+	64	NuclAT_38	-	-
-	2219360..2219423	+	64	NuclAT_38	-	-
-	2219360..2219423	+	64	NuclAT_38	-	-
-	2219360..2219423	+	64	NuclAT_38	-	-
-	2219360..2219423	+	64	NuclAT_40	-	-
-	2219360..2219423	+	64	NuclAT_40	-	-
-	2219360..2219423	+	64	NuclAT_40	-	-
-	2219360..2219423	+	64	NuclAT_40	-	-
-	2219360..2219423	+	64	NuclAT_42	-	-
-	2219360..2219423	+	64	NuclAT_42	-	-
-	2219360..2219423	+	64	NuclAT_42	-	-
-	2219360..2219423	+	64	NuclAT_42	-	-
-	2219360..2219423	+	64	NuclAT_44	-	-
-	2219360..2219423	+	64	NuclAT_44	-	-
-	2219360..2219423	+	64	NuclAT_44	-	-
-	2219360..2219423	+	64	NuclAT_44	-	-
NBY23_RS11090	2219736..2219843	-	108	WP_074147554.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2219890..2219956	+	67	-	-	Antitoxin
NBY23_RS11095	2220248..2221348	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
NBY23_RS11100	2221618..2221848	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
NBY23_RS11105	2222006..2222701	+	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
NBY23_RS11110	2222745..2223098	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
NBY23_RS11115	2223283..2224677	+	1395	WP_000086201.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T246943 WP_074147554.1 NZ_CP098195:c2219843-2219736 [Escherichia coli]
MTLAQFAMTFWHDLAAPILTGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT246943 NZ_CP098195:2219890-2219956 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin