Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60535..60789 | Replicon | plasmid pZ0117ECO0116-1 |
| Accession | NZ_CP098193 | ||
| Organism | Escherichia coli strain Z0117EC0116 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NBY24_RS24155 | Protein ID | WP_001312851.1 |
| Coordinates | 60535..60684 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60728..60789 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY24_RS24110 (56078) | 56078..56425 | + | 348 | Protein_66 | IS1-like element IS1A family transposase | - |
| NBY24_RS24115 (56441) | 56441..56761 | - | 321 | Protein_67 | serine acetyltransferase | - |
| NBY24_RS24120 (56865) | 56865..57152 | - | 288 | WP_000222760.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NBY24_RS24125 (57149) | 57149..57400 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NBY24_RS24130 (58363) | 58363..59220 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NBY24_RS24135 (59213) | 59213..59695 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NBY24_RS24140 (59688) | 59688..59735 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NBY24_RS24145 (59726) | 59726..59977 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NBY24_RS24150 (59994) | 59994..60251 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NBY24_RS24155 (60535) | 60535..60684 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (60728) | 60728..60789 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (60728) | 60728..60789 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (60728) | 60728..60789 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (60728) | 60728..60789 | + | 62 | NuclAT_1 | - | Antitoxin |
| NBY24_RS24160 (61045) | 61045..61119 | - | 75 | Protein_76 | endonuclease | - |
| NBY24_RS24165 (61365) | 61365..61577 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NBY24_RS24170 (61713) | 61713..62273 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NBY24_RS24175 (62376) | 62376..63236 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NBY24_RS24180 (63295) | 63295..64041 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN | 1..192025 | 192025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T246925 WP_001312851.1 NZ_CP098193:c60684-60535 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT246925 NZ_CP098193:60728-60789 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|