Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1268068..1268795 | Replicon | chromosome |
| Accession | NZ_CP098192 | ||
| Organism | Escherichia coli strain Z0117EC0116 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | NBY24_RS06230 | Protein ID | WP_000547564.1 |
| Coordinates | 1268068..1268379 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBY24_RS06235 | Protein ID | WP_000126294.1 |
| Coordinates | 1268376..1268795 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY24_RS06200 (1263210) | 1263210..1264919 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
| NBY24_RS06205 (1264929) | 1264929..1265471 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| NBY24_RS06210 (1265471) | 1265471..1266238 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NBY24_RS06215 (1266235) | 1266235..1266645 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| NBY24_RS06220 (1266638) | 1266638..1267108 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| NBY24_RS06225 (1267133) | 1267133..1267894 | + | 762 | WP_001026446.1 | hypothetical protein | - |
| NBY24_RS06230 (1268068) | 1268068..1268379 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NBY24_RS06235 (1268376) | 1268376..1268795 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NBY24_RS06240 (1268909) | 1268909..1270333 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| NBY24_RS06245 (1270342) | 1270342..1271799 | - | 1458 | WP_250780765.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| NBY24_RS06250 (1272059) | 1272059..1273069 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| NBY24_RS06255 (1273218) | 1273218..1273745 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T246913 WP_000547564.1 NZ_CP098192:1268068-1268379 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT246913 WP_000126294.1 NZ_CP098192:1268376-1268795 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|