Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 768354..769047 | Replicon | chromosome |
| Accession | NZ_CP098192 | ||
| Organism | Escherichia coli strain Z0117EC0116 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | NBY24_RS03745 | Protein ID | WP_000415584.1 |
| Coordinates | 768354..768650 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | NBY24_RS03750 | Protein ID | WP_000650107.1 |
| Coordinates | 768652..769047 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY24_RS03715 (764029) | 764029..764343 | - | 315 | WP_250780761.1 | putative quinol monooxygenase | - |
| NBY24_RS03720 (764374) | 764374..764955 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| NBY24_RS03725 (765065) | 765065..766414 | - | 1350 | WP_000673406.1 | quorum sensing histidine kinase QseC | - |
| NBY24_RS03730 (766411) | 766411..767070 | - | 660 | WP_001221491.1 | quorum sensing response regulator transcription factor QseB | - |
| NBY24_RS03735 (767222) | 767222..767614 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| NBY24_RS03740 (767667) | 767667..768149 | + | 483 | WP_000183494.1 | GyrI-like domain-containing protein | - |
| NBY24_RS03745 (768354) | 768354..768650 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| NBY24_RS03750 (768652) | 768652..769047 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| NBY24_RS03755 (769180) | 769180..770787 | + | 1608 | WP_001324265.1 | ABC transporter substrate-binding protein | - |
| NBY24_RS03760 (770925) | 770925..773183 | + | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | sul2 / tet(B) | rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG | 731050..936763 | 205713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T246908 WP_000415584.1 NZ_CP098192:768354-768650 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT246908 WP_000650107.1 NZ_CP098192:768652-769047 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|