Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 62128..62392 Replicon plasmid pZ0117EC0117-4
Accession NZ_CP098191
Organism Escherichia coli strain Z0117EC0117

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NBY25_RS25565 Protein ID WP_001387489.1
Coordinates 62128..62280 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 62332..62392 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY25_RS25535 (57403) 57403..59571 + 2169 WP_250782059.1 DotA/TraY family protein -
NBY25_RS25540 (59645) 59645..60295 + 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
NBY25_RS25545 (60367) 60367..60576 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
NBY25_RS25550 (60968) 60968..61144 + 177 WP_001054903.1 hypothetical protein -
NBY25_RS25835 (61209) 61209..61304 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
NBY25_RS25560 (61805) 61805..62056 + 252 WP_001291964.1 hypothetical protein -
NBY25_RS25565 (62128) 62128..62280 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (62332) 62332..62392 + 61 NuclAT_0 - Antitoxin
- (62332) 62332..62392 + 61 NuclAT_0 - Antitoxin
- (62332) 62332..62392 + 61 NuclAT_0 - Antitoxin
- (62332) 62332..62392 + 61 NuclAT_0 - Antitoxin
NBY25_RS25570 (62907) 62907..63686 + 780 WP_275542888.1 protein FinQ -
- (63756) 63756..63813 + 58 NuclAT_1 - -
- (63756) 63756..63813 + 58 NuclAT_1 - -
- (63756) 63756..63813 + 58 NuclAT_1 - -
- (63756) 63756..63813 + 58 NuclAT_1 - -
NBY25_RS25575 (63993) 63993..65201 + 1209 WP_011264049.1 IncI1-type conjugal transfer protein TrbA -
NBY25_RS25580 (65220) 65220..66290 + 1071 WP_000151590.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-14 - 1..91188 91188


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T246901 WP_001387489.1 NZ_CP098191:c62280-62128 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT246901 NZ_CP098191:62332-62392 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References