Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4920269..4920491 Replicon chromosome
Accession NZ_CP098187
Organism Escherichia coli strain Z0117EC0117

Toxin (Protein)


Gene name ldrD Uniprot ID A0A0D6GD35
Locus tag NBY25_RS23925 Protein ID WP_000170745.1
Coordinates 4920269..4920376 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4920433..4920491 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY25_RS23900 4915522..4916274 - 753 WP_000279525.1 cellulose biosynthesis protein BcsQ -
NBY25_RS23905 4916286..4916474 - 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
NBY25_RS23910 4916747..4918318 + 1572 WP_001204945.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
NBY25_RS23915 4918315..4918506 + 192 WP_000988311.1 cellulose biosynthesis protein BcsF -
NBY25_RS23920 4918503..4920182 + 1680 WP_000191567.1 cellulose biosynthesis protein BcsG -
NBY25_RS23925 4920269..4920376 - 108 WP_000170745.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4920433..4920491 + 59 - - Antitoxin
NBY25_RS23930 4920852..4922123 + 1272 WP_001467807.1 amino acid permease -
NBY25_RS23935 4922153..4923157 - 1005 WP_000103583.1 dipeptide ABC transporter ATP-binding subunit DppF -
NBY25_RS23940 4923154..4924137 - 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
NBY25_RS23945 4924148..4925050 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3855.68 Da        Isoelectric Point: 9.0157

>T246899 WP_000170745.1 NZ_CP098187:c4920376-4920269 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 59 bp

>AT246899 NZ_CP098187:4920433-4920491 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6GD35

Antitoxin

Download structure file

References