Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3941157..3941884 | Replicon | chromosome |
| Accession | NZ_CP098187 | ||
| Organism | Escherichia coli strain Z0117EC0117 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | NBY25_RS19225 | Protein ID | WP_000547563.1 |
| Coordinates | 3941573..3941884 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NBY25_RS19220 | Protein ID | WP_000126304.1 |
| Coordinates | 3941157..3941576 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY25_RS19205 (3937320) | 3937320..3939572 | - | 2253 | WP_001535518.1 | carbamoyltransferase HypF | - |
| NBY25_RS19210 (3939725) | 3939725..3940252 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| NBY25_RS19215 (3940637) | 3940637..3941065 | + | 429 | WP_000536066.1 | DUF4259 domain-containing protein | - |
| NBY25_RS19220 (3941157) | 3941157..3941576 | - | 420 | WP_000126304.1 | helix-turn-helix domain-containing protein | Antitoxin |
| NBY25_RS19225 (3941573) | 3941573..3941884 | - | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NBY25_RS19230 (3942047) | 3942047..3942802 | - | 756 | WP_001314074.1 | hypothetical protein | - |
| NBY25_RS19235 (3942845) | 3942845..3943312 | - | 468 | WP_000132955.1 | hydrogenase maturation peptidase HycI | - |
| NBY25_RS19240 (3943305) | 3943305..3943715 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| NBY25_RS19245 (3943712) | 3943712..3944479 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| NBY25_RS19250 (3944479) | 3944479..3945021 | - | 543 | WP_000493800.1 | formate hydrogenlyase subunit HycF | - |
| NBY25_RS19255 (3945031) | 3945031..3946740 | - | 1710 | WP_001288123.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3931812..3970730 | 38918 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T246896 WP_000547563.1 NZ_CP098187:c3941884-3941573 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15474.50 Da Isoelectric Point: 4.4596
>AT246896 WP_000126304.1 NZ_CP098187:c3941576-3941157 [Escherichia coli]
MTANAVRAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAVRAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|