Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 909285..909543 | Replicon | chromosome |
| Accession | NZ_CP098187 | ||
| Organism | Escherichia coli strain Z0117EC0117 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | NBY25_RS04375 | Protein ID | WP_000809168.1 |
| Coordinates | 909285..909437 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 909486..909543 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY25_RS04355 | 904530..905243 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
| NBY25_RS04360 | 905269..905673 | - | 405 | WP_000843687.1 | DUF2541 family protein | - |
| NBY25_RS04365 | 906045..907961 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| NBY25_RS04370 | 908050..909180 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| NBY25_RS04375 | 909285..909437 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 909486..909543 | + | 58 | - | - | Antitoxin |
| NBY25_RS04380 | 910052..910813 | + | 762 | WP_001274832.1 | outer membrane protein OmpK | - |
| NBY25_RS04385 | 910833..912326 | + | 1494 | WP_001468392.1 | sulfatase-like hydrolase/transferase | - |
| NBY25_RS04390 | 912455..913714 | + | 1260 | WP_000494928.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T246885 WP_000809168.1 NZ_CP098187:c909437-909285 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT246885 NZ_CP098187:909486-909543 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|