Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54319..54573 | Replicon | plasmid pZ0117ECO0133-2 |
| Accession | NZ_CP098185 | ||
| Organism | Escherichia coli strain Z0117EC0133 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NBY27_RS24680 | Protein ID | WP_001312851.1 |
| Coordinates | 54424..54573 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 54319..54380 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY27_RS24635 (49728) | 49728..50459 | + | 732 | WP_053285825.1 | conjugal transfer complement resistance protein TraT | - |
| NBY27_RS24640 (50531) | 50531..51142 | + | 612 | WP_000908442.1 | hypothetical protein | - |
| NBY27_RS24645 (51424) | 51424..51937 | + | 514 | Protein_63 | TraD N-terminal domain-containing protein | - |
| NBY27_RS24650 (51996) | 51996..52142 | + | 147 | WP_249517175.1 | hypothetical protein | - |
| NBY27_RS24655 (52072) | 52072..52308 | + | 237 | Protein_65 | TraX family protein | - |
| NBY27_RS24660 (52363) | 52363..52923 | + | 561 | WP_000139359.1 | fertility inhibition protein FinO | - |
| NBY27_RS24665 (53059) | 53059..53247 | + | 189 | WP_001345829.1 | hypothetical protein | - |
| NBY27_RS24670 (53445) | 53445..53531 | + | 87 | Protein_68 | endonuclease | - |
| NBY27_RS24675 (53712) | 53712..54023 | - | 312 | WP_000802277.1 | hypothetical protein | - |
| - (54319) | 54319..54380 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (54319) | 54319..54380 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (54319) | 54319..54380 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (54319) | 54319..54380 | - | 62 | NuclAT_0 | - | Antitoxin |
| NBY27_RS24680 (54424) | 54424..54573 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NBY27_RS24685 (54857) | 54857..55114 | + | 258 | WP_000083834.1 | replication regulatory protein RepA | - |
| NBY27_RS24690 (55348) | 55348..55422 | + | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| NBY27_RS24695 (55415) | 55415..55897 | + | 483 | WP_074400318.1 | hypothetical protein | - |
| NBY27_RS24700 (55890) | 55890..56747 | + | 858 | WP_019842754.1 | incFII family plasmid replication initiator RepA | - |
| NBY27_RS24705 (57699) | 57699..57950 | + | 252 | WP_001139206.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| NBY27_RS24710 (57947) | 57947..58234 | + | 288 | WP_000222771.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NBY27_RS24715 (58602) | 58602..58715 | - | 114 | Protein_77 | alkaline phosphatase | - |
| NBY27_RS24720 (58714) | 58714..58919 | + | 206 | Protein_78 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pefD | 1..68250 | 68250 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T246879 WP_001312851.1 NZ_CP098185:54424-54573 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT246879 NZ_CP098185:c54380-54319 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
