Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-MqsA
Location 33474..34123 Replicon plasmid pZ0117ECO0133-2
Accession NZ_CP098185
Organism Escherichia coli strain Z0117EC0133

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NBY27_RS24505 Protein ID WP_021559037.1
Coordinates 33474..33812 (+) Length 113 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NBY27_RS24510 Protein ID WP_021559036.1
Coordinates 33812..34123 (+) Length 104 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY27_RS24470 (28761) 28761..29003 + 243 WP_256500719.1 tyrosine-type recombinase/integrase -
NBY27_RS24475 (29378) 29378..30583 + 1206 WP_021559039.1 AAA family ATPase -
NBY27_RS24480 (30580) 30580..31542 + 963 WP_097333565.1 ParB family protein -
NBY27_RS24485 (31683) 31683..31853 - 171 Protein_31 DUF4113 domain-containing protein -
NBY27_RS24490 (31956) 31956..32222 + 267 Protein_32 hypothetical protein -
NBY27_RS24495 (32217) 32217..32336 + 120 Protein_33 hypothetical protein -
NBY27_RS24500 (33043) 33043..33195 - 153 WP_157901341.1 hypothetical protein -
NBY27_RS24505 (33474) 33474..33812 + 339 WP_021559037.1 hypothetical protein Toxin
NBY27_RS24510 (33812) 33812..34123 + 312 WP_021559036.1 type II toxin-antitoxin system MqsA family antitoxin Antitoxin
NBY27_RS24515 (34476) 34476..34745 + 270 Protein_37 ParA family protein -
NBY27_RS24520 (34742) 34742..35041 + 300 Protein_38 chromosome partitioning protein ParB -
NBY27_RS24525 (35119) 35119..35858 + 740 Protein_39 IS3-like element IS2 family transposase -
NBY27_RS24530 (35818) 35818..36042 + 225 WP_250791047.1 hypothetical protein -
NBY27_RS24535 (36040) 36040..36194 - 155 Protein_41 hypothetical protein -
NBY27_RS24540 (36712) 36712..36942 + 231 WP_000218642.1 hypothetical protein -
NBY27_RS24545 (36994) 36994..38388 + 1395 WP_064484940.1 DUF3560 domain-containing protein -
NBY27_RS24550 (38402) 38402..38965 + 564 WP_001377760.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefD 1..68250 68250
- flank IS/Tn - - 35119..35484 365


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(44-87)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 13508.48 Da        Isoelectric Point: 9.3917

>T246878 WP_021559037.1 NZ_CP098185:33474-33812 [Escherichia coli]
MEALFVELPPFERHRAEYLTDDEFREFQQMLLENPVCGDVIQHTGGLRKVRFGDARRNKGKRGGIRVIYYWYLEKSHFLL
FTLYDKDQKDDLTKAQRDILREMLEQAKRRGR

Download         Length: 339 bp

Antitoxin


Download         Length: 104 a.a.        Molecular weight: 11668.53 Da        Isoelectric Point: 10.4005

>AT246878 WP_021559036.1 NZ_CP098185:33812-34123 [Escherichia coli]
MKERDIFGELHEGMVAWGEFNDGKKTLRTHRASVKPVSMTPAEVKAVREKLRLSQAVFAQYLHTGVTTLQNWEQGLARPN
KQAILLIKMVDRNPQTLNELAAL

Download         Length: 312 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References