Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4079410..4080209 | Replicon | chromosome |
| Accession | NZ_CP098183 | ||
| Organism | Escherichia coli strain Z0117EC0133 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F4VJD3 |
| Locus tag | NBY27_RS19850 | Protein ID | WP_000347266.1 |
| Coordinates | 4079745..4080209 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NBY27_RS19845 | Protein ID | WP_001307405.1 |
| Coordinates | 4079410..4079745 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY27_RS19830 (4075195) | 4075195..4075965 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NBY27_RS19835 (4075981) | 4075981..4077315 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NBY27_RS19840 (4077690) | 4077690..4079261 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| NBY27_RS19845 (4079410) | 4079410..4079745 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NBY27_RS19850 (4079745) | 4079745..4080209 | + | 465 | WP_000347266.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NBY27_RS19855 (4080264) | 4080264..4081073 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NBY27_RS19860 (4081322) | 4081322..4082602 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NBY27_RS19865 (4082625) | 4082625..4083098 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NBY27_RS19870 (4083109) | 4083109..4083888 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NBY27_RS19875 (4083878) | 4083878..4084756 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NBY27_RS19880 (4084774) | 4084774..4085208 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4068754..4080209 | 11455 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17841.18 Da Isoelectric Point: 9.4947
>T246875 WP_000347266.1 NZ_CP098183:4079745-4080209 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A836NGD2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |