Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2156333..2156704 | Replicon | chromosome |
| Accession | NZ_CP098183 | ||
| Organism | Escherichia coli strain Z0117EC0133 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | - |
| Locus tag | NBY27_RS10490 | Protein ID | WP_064484558.1 |
| Coordinates | 2156510..2156704 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2156333..2156511 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY27_RS10460 (2152085) | 2152085..2152258 | + | 174 | WP_001296046.1 | protein YnaL | - |
| NBY27_RS10465 (2152288) | 2152288..2153661 | + | 1374 | WP_064484557.1 | ATP-dependent RNA helicase DbpA | - |
| NBY27_RS10470 (2153790) | 2153790..2154725 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| NBY27_RS10475 (2154777) | 2154777..2156012 | - | 1236 | WP_000040858.1 | site-specific integrase | - |
| NBY27_RS10480 (2156014) | 2156014..2156229 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2156333) | 2156333..2156511 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2156333) | 2156333..2156511 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2156333) | 2156333..2156511 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2156333) | 2156333..2156511 | + | 179 | NuclAT_0 | - | Antitoxin |
| NBY27_RS10485 (2156308) | 2156308..2156517 | - | 210 | WP_021565074.1 | double-strand break reduction protein RcbA | - |
| NBY27_RS10490 (2156510) | 2156510..2156704 | - | 195 | WP_064484558.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| NBY27_RS10495 (2156761) | 2156761..2157570 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| NBY27_RS10500 (2157563) | 2157563..2160163 | - | 2601 | WP_021565075.1 | exodeoxyribonuclease VIII | - |
| NBY27_RS10505 (2160265) | 2160265..2160540 | - | 276 | WP_001344816.1 | hypothetical protein | - |
| NBY27_RS10510 (2160615) | 2160615..2160785 | - | 171 | WP_001352098.1 | YdaE family protein | - |
| NBY27_RS10515 (2160785) | 2160785..2161006 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2154777..2178967 | 24190 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7076.92 Da Isoelectric Point: 8.6419
>T246862 WP_064484558.1 NZ_CP098183:c2156704-2156510 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTDYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTDYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT246862 NZ_CP098183:2156333-2156511 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGAAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGAAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
