Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 156886..157488 | Replicon | chromosome |
Accession | NZ_CP098183 | ||
Organism | Escherichia coli strain Z0117EC0133 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NBY27_RS00760 | Protein ID | WP_000897305.1 |
Coordinates | 156886..157197 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY27_RS00765 | Protein ID | WP_000356397.1 |
Coordinates | 157198..157488 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY27_RS00730 (151916) | 151916..152701 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NBY27_RS00735 (152800) | 152800..153399 | + | 600 | WP_240761453.1 | glucose-1-phosphatase | - |
NBY27_RS00740 (153393) | 153393..154265 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NBY27_RS00745 (154262) | 154262..154699 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NBY27_RS00750 (154744) | 154744..155685 | + | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
NBY27_RS00755 (155749) | 155749..156657 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NBY27_RS00760 (156886) | 156886..157197 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NBY27_RS00765 (157198) | 157198..157488 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NBY27_RS00770 (158093) | 158093..158311 | + | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
NBY27_RS00775 (158530) | 158530..158772 | + | 243 | WP_001086388.1 | protein YiiF | - |
NBY27_RS00780 (159102) | 159102..160031 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
NBY27_RS00785 (160028) | 160028..160663 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
NBY27_RS00790 (160660) | 160660..161562 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T246855 WP_000897305.1 NZ_CP098183:156886-157197 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|