Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 12270..12916 | Replicon | plasmid pZ0117EC0148-4 |
Accession | NZ_CP098182 | ||
Organism | Escherichia coli strain Z0117EC0148 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NBY28_RS25175 | Protein ID | WP_000269912.1 |
Coordinates | 12270..12617 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1V3UZT0 |
Locus tag | NBY28_RS25180 | Protein ID | WP_001259436.1 |
Coordinates | 12617..12916 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY28_RS25150 (NBY28_25150) | 8690..9013 | - | 324 | WP_250844260.1 | hypothetical protein | - |
NBY28_RS25155 (NBY28_25155) | 9095..9649 | + | 555 | WP_033561046.1 | recombinase family protein | - |
NBY28_RS25160 (NBY28_25160) | 9831..10808 | + | 978 | WP_224922639.1 | plasmid replication initiator RepA | - |
NBY28_RS25165 (NBY28_25165) | 11452..11739 | + | 288 | WP_000356589.1 | hypothetical protein | - |
NBY28_RS25170 (NBY28_25170) | 11763..12026 | + | 264 | WP_000424604.1 | hypothetical protein | - |
NBY28_RS25175 (NBY28_25175) | 12270..12617 | + | 348 | WP_000269912.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY28_RS25180 (NBY28_25180) | 12617..12916 | + | 300 | WP_001259436.1 | XRE family transcriptional regulator | Antitoxin |
NBY28_RS25185 (NBY28_25185) | 13079..13459 | + | 381 | WP_111982070.1 | hypothetical protein | - |
NBY28_RS25190 (NBY28_25190) | 13523..13795 | + | 273 | WP_000148348.1 | helix-turn-helix domain-containing protein | - |
NBY28_RS25195 (NBY28_25200) | 14605..15747 | - | 1143 | WP_089592802.1 | ORF6N domain-containing protein | - |
NBY28_RS25200 (NBY28_25205) | 15744..15935 | - | 192 | WP_089592803.1 | hypothetical protein | - |
NBY28_RS25210 (NBY28_25215) | 16385..16978 | + | 594 | WP_250844261.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..52058 | 52058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13545.51 Da Isoelectric Point: 8.8337
>T246854 WP_000269912.1 NZ_CP098182:12270-12617 [Escherichia coli]
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFDDWLNEQEDALQEKVLADLKKLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|