Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 38609..38873 Replicon plasmid pZ0117EC0148-2
Accession NZ_CP098180
Organism Escherichia coli strain Z0117EC0148

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NBY28_RS24350 Protein ID WP_001387489.1
Coordinates 38609..38761 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 38813..38873 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY28_RS24325 (33762) 33762..35930 + 2169 WP_000698368.1 DotA/TraY family protein -
NBY28_RS24330 (36001) 36001..36663 + 663 WP_060527638.1 plasmid IncI1-type surface exclusion protein ExcA -
NBY28_RS24335 (36761) 36761..36970 + 210 WP_001140543.1 hemolysin expression modulator Hha -
NBY28_RS24340 (37179) 37179..37355 + 177 WP_001054900.1 hypothetical protein -
- (37841) 37841..37892 + 52 NuclAT_1 - -
- (37841) 37841..37892 + 52 NuclAT_1 - -
- (37841) 37841..37892 + 52 NuclAT_1 - -
- (37841) 37841..37892 + 52 NuclAT_1 - -
NBY28_RS24345 (38286) 38286..38537 + 252 WP_024171163.1 hypothetical protein -
NBY28_RS24350 (38609) 38609..38761 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (38813) 38813..38873 + 61 NuclAT_0 - Antitoxin
- (38813) 38813..38873 + 61 NuclAT_0 - Antitoxin
- (38813) 38813..38873 + 61 NuclAT_0 - Antitoxin
- (38813) 38813..38873 + 61 NuclAT_0 - Antitoxin
NBY28_RS24355 (39053) 39053..40261 + 1209 WP_001493816.1 IncI1-type conjugal transfer protein TrbA -
NBY28_RS24360 (40280) 40280..41350 + 1071 WP_136360499.1 IncI1-type conjugal transfer protein TrbB -
NBY28_RS24365 (41343) 41343..43634 + 2292 WP_024168876.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-14 / qnrS1 - 1..100768 100768


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T246848 WP_001387489.1 NZ_CP098180:c38761-38609 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT246848 NZ_CP098180:38813-38873 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References