Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 113530..113784 | Replicon | plasmid pZ0117EC0148-1 |
| Accession | NZ_CP098179 | ||
| Organism | Escherichia coli strain Z0117EC0148 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NBY28_RS24125 | Protein ID | WP_001312851.1 |
| Coordinates | 113530..113679 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 113723..113784 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY28_RS24080 (109082) | 109082..109483 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NBY28_RS24085 (109416) | 109416..109673 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NBY28_RS24090 (109766) | 109766..110419 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NBY28_RS24095 (110517) | 110517..110657 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| NBY28_RS24100 (111358) | 111358..112215 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| NBY28_RS24105 (112208) | 112208..112690 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| NBY28_RS24110 (112683) | 112683..112730 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| NBY28_RS24115 (112721) | 112721..112972 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| NBY28_RS24120 (112989) | 112989..113246 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| NBY28_RS24125 (113530) | 113530..113679 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (113723) | 113723..113784 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (113723) | 113723..113784 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (113723) | 113723..113784 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (113723) | 113723..113784 | + | 62 | NuclAT_1 | - | Antitoxin |
| NBY28_RS24130 (114040) | 114040..114114 | - | 75 | Protein_135 | endonuclease | - |
| NBY28_RS24135 (114360) | 114360..114572 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| NBY28_RS24140 (114708) | 114708..115268 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| NBY28_RS24145 (115371) | 115371..116231 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| NBY28_RS24150 (116290) | 116290..117036 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / blaTEM-1B / tet(A) | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN | 1..121118 | 121118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T246844 WP_001312851.1 NZ_CP098179:c113679-113530 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT246844 NZ_CP098179:113723-113784 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|