Detailed information of TA system TA246841

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 30741..31167
• Replicon: plasmid pZ0117EC0148-1
• Accession: NZ_CP098179
• Organism: Escherichia coli strain Z0117EC0148

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NBY28_RS23660
• Protein ID: WP_001372321.1
• Coordinates: 30741..30866 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	30943..31167 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NBY28_RS23620 (26115)	26115..26804	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
NBY28_RS23625 (26991)	26991..27374	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NBY28_RS23630 (27707)	27707..28297	+	591	WP_001376243.1	transglycosylase SLT domain-containing protein	-
NBY28_RS23635 (28594)	28594..29415	-	822	WP_001234426.1	DUF932 domain-containing protein	-
NBY28_RS23640 (29533)	29533..29820	-	288	WP_000107535.1	hypothetical protein	-
NBY28_RS23645 (29845)	29845..30051	-	207	WP_000547968.1	hypothetical protein	-
NBY28_RS23650 (30121)	30121..30293	+	173	Protein_39	hypothetical protein	-
NBY28_RS23655 (30291)	30291..30521	-	231	WP_071586998.1	hypothetical protein	-
NBY28_RS23660 (30741)	30741..30866	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NBY28_RS23665 (30808)	30808..30957	-	150	Protein_42	plasmid maintenance protein Mok	-
- (30943)	30943..31167	-	225	NuclAT_0	-	Antitoxin
- (30943)	30943..31167	-	225	NuclAT_0	-	Antitoxin
- (30943)	30943..31167	-	225	NuclAT_0	-	Antitoxin
- (30943)	30943..31167	-	225	NuclAT_0	-	Antitoxin
NBY28_RS23670 (30979)	30979..31167	+	189	WP_001299721.1	hypothetical protein	-
NBY28_RS23675 (31136)	31136..31898	-	763	Protein_44	plasmid SOS inhibition protein A	-
NBY28_RS23680 (31895)	31895..32329	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
NBY28_RS23685 (32384)	32384..32581	-	198	Protein_46	hypothetical protein	-
NBY28_RS23690 (32609)	32609..32842	-	234	WP_000005987.1	DUF905 family protein	-
NBY28_RS23695 (32910)	32910..33449	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
NBY28_RS23700 (33475)	33475..33681	-	207	WP_000275856.1	hypothetical protein	-
NBY28_RS23705 (33751)	33751..33831	+	81	Protein_50	hypothetical protein	-
NBY28_RS23710 (34014)	34014..34183	-	170	Protein_51	hypothetical protein	-
NBY28_RS23715 (34820)	34820..35791	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / blaTEM-1B / tet(A)	iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN	1..121118	121118

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T246841 WP_001372321.1 NZ_CP098179:c30866-30741 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT246841 NZ_CP098179:c31167-30943 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin