Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4176395..4177194 | Replicon | chromosome |
| Accession | NZ_CP098178 | ||
| Organism | Escherichia coli strain Z0117EC0148 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | NBY28_RS20355 | Protein ID | WP_000347267.1 |
| Coordinates | 4176730..4177194 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | NBY28_RS20350 | Protein ID | WP_001307405.1 |
| Coordinates | 4176395..4176730 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY28_RS20335 (4172180) | 4172180..4172950 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NBY28_RS20340 (4172966) | 4172966..4174300 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NBY28_RS20345 (4174675) | 4174675..4176246 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| NBY28_RS20350 (4176395) | 4176395..4176730 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NBY28_RS20355 (4176730) | 4176730..4177194 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NBY28_RS20360 (4177249) | 4177249..4178058 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NBY28_RS20365 (4178307) | 4178307..4179587 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NBY28_RS20370 (4179610) | 4179610..4180083 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NBY28_RS20375 (4180094) | 4180094..4180873 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NBY28_RS20380 (4180863) | 4180863..4181741 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NBY28_RS20385 (4181759) | 4181759..4182193 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4165407..4177194 | 11787 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T246838 WP_000347267.1 NZ_CP098178:4176730-4177194 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |