Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 2266741..2267112 | Replicon | chromosome |
| Accession | NZ_CP098178 | ||
| Organism | Escherichia coli strain Z0117EC0148 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | NBY28_RS11160 | Protein ID | WP_001317028.1 |
| Coordinates | 2266918..2267112 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 2266741..2266919 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY28_RS25525 (2262493) | 2262493..2262666 | + | 174 | WP_001296046.1 | protein YnaL | - |
| NBY28_RS11135 (2262696) | 2262696..2264069 | + | 1374 | WP_000123739.1 | ATP-dependent RNA helicase DbpA | - |
| NBY28_RS11140 (2264198) | 2264198..2265133 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| NBY28_RS11145 (2265185) | 2265185..2266420 | - | 1236 | WP_000040858.1 | site-specific integrase | - |
| NBY28_RS11150 (2266422) | 2266422..2266637 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (2266741) | 2266741..2266919 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2266741) | 2266741..2266919 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2266741) | 2266741..2266919 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (2266741) | 2266741..2266919 | + | 179 | NuclAT_0 | - | Antitoxin |
| NBY28_RS11155 (2266716) | 2266716..2266925 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
| NBY28_RS11160 (2266918) | 2266918..2267112 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| NBY28_RS11165 (2267169) | 2267169..2267978 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
| NBY28_RS11170 (2267971) | 2267971..2268768 | - | 798 | Protein_2172 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| NBY28_RS11180 (2270217) | 2270217..2270555 | - | 339 | WP_000149055.1 | DUF1971 domain-containing protein | - |
| NBY28_RS11185 (2271369) | 2271369..2271968 | + | 600 | WP_000940319.1 | DUF1367 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2265185..2285800 | 20615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T246826 WP_001317028.1 NZ_CP098178:c2267112-2266918 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT246826 NZ_CP098178:2266741-2266919 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
