Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 215453..216180 Replicon plasmid pZ0117KP0001-1
Accession NZ_CP098176
Organism Klebsiella pneumoniae strain Z0117KP0001

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LNL2
Locus tag NBY29_RS26670 Protein ID WP_004118600.1
Coordinates 215869..216180 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag NBY29_RS26665 Protein ID WP_000990392.1
Coordinates 215453..215872 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY29_RS26630 (NBY29_26630) 211140..211502 - 363 WP_020324593.1 arsenite efflux transporter metallochaperone ArsD -
NBY29_RS26635 (NBY29_26635) 211550..211903 - 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NBY29_RS26640 (NBY29_26640) 212196..212336 + 141 WP_004118614.1 hypothetical protein -
NBY29_RS26645 (NBY29_26645) 212456..212812 + 357 WP_077253206.1 Ref family recombination enhancement nuclease -
NBY29_RS26650 (NBY29_26650) 213236..213895 + 660 WP_000078540.1 hypothetical protein -
NBY29_RS26655 (NBY29_26655) 213892..214221 + 330 WP_004118613.1 hypothetical protein -
NBY29_RS26660 (NBY29_26660) 214214..215416 + 1203 WP_003031541.1 hypothetical protein -
NBY29_RS26665 (NBY29_26665) 215453..215872 - 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
NBY29_RS26670 (NBY29_26670) 215869..216180 - 312 WP_004118600.1 type II toxin-antitoxin system HigB family toxin Toxin
NBY29_RS26675 (NBY29_26675) 216391..216771 + 381 Protein_249 gluconate permease -
NBY29_RS26680 (NBY29_26680) 216821..217516 - 696 WP_004118595.1 lactate utilization protein C -
NBY29_RS26685 (NBY29_26685) 217509..218936 - 1428 WP_000023895.1 LutB/LldF family L-lactate oxidation iron-sulfur protein -
NBY29_RS26690 (NBY29_26690) 218947..219666 - 720 WP_001102107.1 (Fe-S)-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / tet(A) / dfrA1 / qacE / sul1 / qnrS1 / blaLAP-2 / aac(3)-IId / blaCTX-M-14 - 1..262875 262875


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12386.14 Da        Isoelectric Point: 10.0935

>T246820 WP_004118600.1 NZ_CP098176:c216180-215869 [Klebsiella pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT246820 WP_000990392.1 NZ_CP098176:c215872-215453 [Klebsiella pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNL2

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References