Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4839388..4839974 Replicon chromosome
Accession NZ_CP098175
Organism Klebsiella pneumoniae strain Z0117KP0001

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NBY29_RS23745 Protein ID WP_023285605.1
Coordinates 4839388..4839756 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY29_RS23750 Protein ID WP_004174006.1
Coordinates 4839753..4839974 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY29_RS23725 (4834891) 4834891..4835961 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NBY29_RS23730 (4835963) 4835963..4836808 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY29_RS23735 (4836805) 4836805..4837692 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY29_RS23740 (4837799) 4837799..4839115 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY29_RS23745 (4839388) 4839388..4839756 - 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY29_RS23750 (4839753) 4839753..4839974 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY29_RS23755 (4840138) 4840138..4840851 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY29_RS23760 (4840853) 4840853..4841620 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY29_RS23765 (4841617) 4841617..4842894 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY29_RS23770 (4842891) 4842891..4843817 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4834154..4854868 20714


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T246819 WP_023285605.1 NZ_CP098175:c4839756-4839388 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246819 WP_004174006.1 NZ_CP098175:c4839974-4839753 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References