Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4813140..4813786 | Replicon | chromosome |
Accession | NZ_CP098175 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0001 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | NBY29_RS23635 | Protein ID | WP_016529833.1 |
Coordinates | 4813439..4813786 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | NBY29_RS23630 | Protein ID | WP_002920557.1 |
Coordinates | 4813140..4813439 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY29_RS23610 (4809346) | 4809346..4810104 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
NBY29_RS23615 (4810154) | 4810154..4810984 | - | 831 | WP_024622927.1 | rhomboid family intramembrane serine protease GlpG | - |
NBY29_RS23620 (4811035) | 4811035..4811364 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NBY29_RS23625 (4811569) | 4811569..4813077 | + | 1509 | WP_023301456.1 | glycerol-3-phosphate dehydrogenase | - |
NBY29_RS23630 (4813140) | 4813140..4813439 | - | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NBY29_RS23635 (4813439) | 4813439..4813786 | - | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY29_RS23640 (4813962) | 4813962..4816409 | - | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
NBY29_RS23645 (4816427) | 4816427..4817860 | - | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T246818 WP_016529833.1 NZ_CP098175:c4813786-4813439 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9BBY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |