Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 2239016..2239602 | Replicon | chromosome |
Accession | NZ_CP098169 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0003 |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | NBY30_RS10570 | Protein ID | WP_002920800.1 |
Coordinates | 2239234..2239602 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | NBY30_RS10565 | Protein ID | WP_004174006.1 |
Coordinates | 2239016..2239237 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY30_RS10545 (2235173) | 2235173..2236099 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NBY30_RS10550 (2236096) | 2236096..2237373 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
NBY30_RS10555 (2237370) | 2237370..2238137 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
NBY30_RS10560 (2238139) | 2238139..2238852 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
NBY30_RS10565 (2239016) | 2239016..2239237 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NBY30_RS10570 (2239234) | 2239234..2239602 | + | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NBY30_RS10575 (2239875) | 2239875..2241191 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
NBY30_RS10580 (2241298) | 2241298..2242185 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
NBY30_RS10585 (2242182) | 2242182..2243027 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
NBY30_RS10590 (2243029) | 2243029..2244099 | + | 1071 | WP_032433652.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2236096..2244836 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T246794 WP_002920800.1 NZ_CP098169:2239234-2239602 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E5YJY7 |