Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2239016..2239602 Replicon chromosome
Accession NZ_CP098169
Organism Klebsiella pneumoniae strain Z0117KP0003

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY30_RS10570 Protein ID WP_002920800.1
Coordinates 2239234..2239602 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY30_RS10565 Protein ID WP_004174006.1
Coordinates 2239016..2239237 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY30_RS10545 (2235173) 2235173..2236099 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NBY30_RS10550 (2236096) 2236096..2237373 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY30_RS10555 (2237370) 2237370..2238137 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY30_RS10560 (2238139) 2238139..2238852 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY30_RS10565 (2239016) 2239016..2239237 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY30_RS10570 (2239234) 2239234..2239602 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY30_RS10575 (2239875) 2239875..2241191 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY30_RS10580 (2241298) 2241298..2242185 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY30_RS10585 (2242182) 2242182..2243027 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY30_RS10590 (2243029) 2243029..2244099 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2236096..2244836 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246794 WP_002920800.1 NZ_CP098169:2239234-2239602 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246794 WP_004174006.1 NZ_CP098169:2239016-2239237 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References