Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4997799..4998385 Replicon chromosome
Accession NZ_CP098165
Organism Klebsiella pneumoniae strain Z0117KP0005

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY34_RS24145 Protein ID WP_002920800.1
Coordinates 4997799..4998167 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY34_RS24150 Protein ID WP_004174006.1
Coordinates 4998164..4998385 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY34_RS24125 (4993302) 4993302..4994372 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NBY34_RS24130 (4994374) 4994374..4995219 - 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY34_RS24135 (4995216) 4995216..4996103 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY34_RS24140 (4996210) 4996210..4997526 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY34_RS24145 (4997799) 4997799..4998167 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY34_RS24150 (4998164) 4998164..4998385 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY34_RS24155 (4998549) 4998549..4999262 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY34_RS24160 (4999264) 4999264..5000031 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY34_RS24165 (5000028) 5000028..5001305 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY34_RS24170 (5001302) 5001302..5002228 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4992565..5013402 20837


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246771 WP_002920800.1 NZ_CP098165:c4998167-4997799 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246771 WP_004174006.1 NZ_CP098165:c4998385-4998164 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References