Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4997799..4998385 | Replicon | chromosome |
| Accession | NZ_CP098165 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0005 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | NBY34_RS24145 | Protein ID | WP_002920800.1 |
| Coordinates | 4997799..4998167 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | NBY34_RS24150 | Protein ID | WP_004174006.1 |
| Coordinates | 4998164..4998385 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY34_RS24125 (4993302) | 4993302..4994372 | - | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| NBY34_RS24130 (4994374) | 4994374..4995219 | - | 846 | WP_032434559.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NBY34_RS24135 (4995216) | 4995216..4996103 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NBY34_RS24140 (4996210) | 4996210..4997526 | - | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NBY34_RS24145 (4997799) | 4997799..4998167 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NBY34_RS24150 (4998164) | 4998164..4998385 | - | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBY34_RS24155 (4998549) | 4998549..4999262 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NBY34_RS24160 (4999264) | 4999264..5000031 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NBY34_RS24165 (5000028) | 5000028..5001305 | - | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| NBY34_RS24170 (5001302) | 5001302..5002228 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 4992565..5013402 | 20837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T246771 WP_002920800.1 NZ_CP098165:c4998167-4997799 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |