Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2820418..2821107 | Replicon | chromosome |
Accession | NZ_CP098165 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0005 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | NBY34_RS13385 | Protein ID | WP_021469727.1 |
Coordinates | 2820790..2821107 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | NBY34_RS13380 | Protein ID | WP_020804705.1 |
Coordinates | 2820418..2820714 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY34_RS13365 (2816810) | 2816810..2818192 | + | 1383 | WP_004151222.1 | MFS transporter | - |
NBY34_RS13370 (2818236) | 2818236..2819852 | + | 1617 | WP_004175961.1 | carbohydrate porin | - |
NBY34_RS13375 (2819893) | 2819893..2820339 | - | 447 | WP_032435212.1 | hypothetical protein | - |
NBY34_RS13380 (2820418) | 2820418..2820714 | - | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
NBY34_RS13385 (2820790) | 2820790..2821107 | - | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY34_RS13390 (2821314) | 2821314..2821541 | - | 228 | WP_002906690.1 | tautomerase PptA | - |
NBY34_RS13395 (2821612) | 2821612..2822229 | - | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
NBY34_RS13400 (2822307) | 2822307..2823158 | - | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
NBY34_RS13405 (2823197) | 2823197..2823976 | - | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
NBY34_RS13410 (2823960) | 2823960..2824886 | - | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
NBY34_RS13415 (2824896) | 2824896..2825405 | - | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T246764 WP_021469727.1 NZ_CP098165:c2821107-2820790 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |