Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4997740..4998326 Replicon chromosome
Accession NZ_CP098161
Organism Klebsiella pneumoniae strain Z0117KP0006

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY36_RS24150 Protein ID WP_002920800.1
Coordinates 4997740..4998108 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY36_RS24155 Protein ID WP_004174006.1
Coordinates 4998105..4998326 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY36_RS24130 (4993243) 4993243..4994313 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NBY36_RS24135 (4994315) 4994315..4995160 - 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY36_RS24140 (4995157) 4995157..4996044 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY36_RS24145 (4996151) 4996151..4997467 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY36_RS24150 (4997740) 4997740..4998108 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY36_RS24155 (4998105) 4998105..4998326 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY36_RS24160 (4998490) 4998490..4999203 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY36_RS24165 (4999205) 4999205..4999972 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY36_RS24170 (4999969) 4999969..5001246 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY36_RS24175 (5001243) 5001243..5002169 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4992506..5013343 20837


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246755 WP_002920800.1 NZ_CP098161:c4998108-4997740 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246755 WP_004174006.1 NZ_CP098161:c4998326-4998105 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References