Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 4997740..4998326 | Replicon | chromosome |
| Accession | NZ_CP098161 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0006 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | W8VD46 |
| Locus tag | NBY36_RS24150 | Protein ID | WP_002920800.1 |
| Coordinates | 4997740..4998108 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | NBY36_RS24155 | Protein ID | WP_004174006.1 |
| Coordinates | 4998105..4998326 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY36_RS24130 (4993243) | 4993243..4994313 | - | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
| NBY36_RS24135 (4994315) | 4994315..4995160 | - | 846 | WP_032434559.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NBY36_RS24140 (4995157) | 4995157..4996044 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NBY36_RS24145 (4996151) | 4996151..4997467 | - | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NBY36_RS24150 (4997740) | 4997740..4998108 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NBY36_RS24155 (4998105) | 4998105..4998326 | - | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBY36_RS24160 (4998490) | 4998490..4999203 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NBY36_RS24165 (4999205) | 4999205..4999972 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NBY36_RS24170 (4999969) | 4999969..5001246 | - | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| NBY36_RS24175 (5001243) | 5001243..5002169 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 4992506..5013343 | 20837 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T246755 WP_002920800.1 NZ_CP098161:c4998108-4997740 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GUD1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E5YJY7 |