Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4971501..4972147 | Replicon | chromosome |
Accession | NZ_CP098161 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0006 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | NBY36_RS24040 | Protein ID | WP_016529833.1 |
Coordinates | 4971800..4972147 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | NBY36_RS24035 | Protein ID | WP_002920557.1 |
Coordinates | 4971501..4971800 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY36_RS24015 (4967707) | 4967707..4968465 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
NBY36_RS24020 (4968515) | 4968515..4969345 | - | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
NBY36_RS24025 (4969396) | 4969396..4969725 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NBY36_RS24030 (4969930) | 4969930..4971438 | + | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
NBY36_RS24035 (4971501) | 4971501..4971800 | - | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NBY36_RS24040 (4971800) | 4971800..4972147 | - | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY36_RS24045 (4972313) | 4972313..4974760 | - | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
NBY36_RS24050 (4974778) | 4974778..4976211 | - | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T246754 WP_016529833.1 NZ_CP098161:c4972147-4971800 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9BBY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |