Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2820354..2821043 | Replicon | chromosome |
| Accession | NZ_CP098161 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0006 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A331C6E2 |
| Locus tag | NBY36_RS13390 | Protein ID | WP_021469727.1 |
| Coordinates | 2820726..2821043 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6B0N7G3 |
| Locus tag | NBY36_RS13385 | Protein ID | WP_020804705.1 |
| Coordinates | 2820354..2820650 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY36_RS13370 (2816746) | 2816746..2818128 | + | 1383 | WP_004151222.1 | MFS transporter | - |
| NBY36_RS13375 (2818172) | 2818172..2819788 | + | 1617 | WP_004175961.1 | carbohydrate porin | - |
| NBY36_RS13380 (2819829) | 2819829..2820275 | - | 447 | WP_032435212.1 | hypothetical protein | - |
| NBY36_RS13385 (2820354) | 2820354..2820650 | - | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
| NBY36_RS13390 (2820726) | 2820726..2821043 | - | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY36_RS13395 (2821250) | 2821250..2821477 | - | 228 | WP_002906690.1 | tautomerase PptA | - |
| NBY36_RS13400 (2821548) | 2821548..2822165 | - | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
| NBY36_RS13405 (2822243) | 2822243..2823094 | - | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
| NBY36_RS13410 (2823133) | 2823133..2823912 | - | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
| NBY36_RS13415 (2823896) | 2823896..2824822 | - | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
| NBY36_RS13420 (2824832) | 2824832..2825341 | - | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T246748 WP_021469727.1 NZ_CP098161:c2821043-2820726 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A331C6E2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B0N7G3 |