Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2534906..2535595 | Replicon | chromosome |
Accession | NZ_CP098159 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0008 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | NBY40_RS12440 | Protein ID | WP_021469727.1 |
Coordinates | 2534906..2535223 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | NBY40_RS12445 | Protein ID | WP_020804705.1 |
Coordinates | 2535299..2535595 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY40_RS12410 (2530608) | 2530608..2531117 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
NBY40_RS12415 (2531127) | 2531127..2532053 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
NBY40_RS12420 (2532037) | 2532037..2532816 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
NBY40_RS12425 (2532855) | 2532855..2533706 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
NBY40_RS12430 (2533784) | 2533784..2534401 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
NBY40_RS12435 (2534472) | 2534472..2534699 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
NBY40_RS12440 (2534906) | 2534906..2535223 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY40_RS12445 (2535299) | 2535299..2535595 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
NBY40_RS12450 (2535674) | 2535674..2536120 | + | 447 | WP_032435212.1 | hypothetical protein | - |
NBY40_RS12455 (2536161) | 2536161..2537777 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
NBY40_RS12460 (2537821) | 2537821..2539203 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T246732 WP_021469727.1 NZ_CP098159:2534906-2535223 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |