Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 357616..358202 Replicon chromosome
Accession NZ_CP098159
Organism Klebsiella pneumoniae strain Z0117KP0008

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY40_RS01680 Protein ID WP_002920800.1
Coordinates 357834..358202 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY40_RS01675 Protein ID WP_004174006.1
Coordinates 357616..357837 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY40_RS01655 (353773) 353773..354699 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NBY40_RS01660 (354696) 354696..355973 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY40_RS01665 (355970) 355970..356737 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY40_RS01670 (356739) 356739..357452 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY40_RS01675 (357616) 357616..357837 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY40_RS01680 (357834) 357834..358202 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY40_RS01685 (358475) 358475..359791 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY40_RS01690 (359898) 359898..360785 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY40_RS01695 (360782) 360782..361627 + 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY40_RS01700 (361629) 361629..362699 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 354696..363436 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246725 WP_002920800.1 NZ_CP098159:357834-358202 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246725 WP_004174006.1 NZ_CP098159:357616-357837 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References