Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2434474..2435163 | Replicon | chromosome |
Accession | NZ_CP098149 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | NBY46_RS11905 | Protein ID | WP_021469727.1 |
Coordinates | 2434474..2434791 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | NBY46_RS11910 | Protein ID | WP_020804705.1 |
Coordinates | 2434867..2435163 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY46_RS11875 (2430176) | 2430176..2430685 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
NBY46_RS11880 (2430695) | 2430695..2431621 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
NBY46_RS11885 (2431605) | 2431605..2432384 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
NBY46_RS11890 (2432423) | 2432423..2433274 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
NBY46_RS11895 (2433352) | 2433352..2433969 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
NBY46_RS11900 (2434040) | 2434040..2434267 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
NBY46_RS11905 (2434474) | 2434474..2434791 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY46_RS11910 (2434867) | 2434867..2435163 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
NBY46_RS11915 (2435242) | 2435242..2435688 | + | 447 | WP_032435212.1 | hypothetical protein | - |
NBY46_RS11920 (2435729) | 2435729..2437345 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
NBY46_RS11925 (2437389) | 2437389..2438771 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T246717 WP_021469727.1 NZ_CP098149:2434474-2434791 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |