Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 357818..358404 Replicon chromosome
Accession NZ_CP098149
Organism Klebsiella pneumoniae strain Z0117KP0019

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY46_RS01675 Protein ID WP_002920800.1
Coordinates 358036..358404 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY46_RS01670 Protein ID WP_004174006.1
Coordinates 357818..358039 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY46_RS01650 (353975) 353975..354901 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NBY46_RS01655 (354898) 354898..356175 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY46_RS01660 (356172) 356172..356939 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY46_RS01665 (356941) 356941..357654 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY46_RS01670 (357818) 357818..358039 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY46_RS01675 (358036) 358036..358404 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY46_RS01680 (358677) 358677..359993 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY46_RS01685 (360100) 360100..360987 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY46_RS01690 (360984) 360984..361829 + 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY46_RS01695 (361831) 361831..362901 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 354898..363638 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246710 WP_002920800.1 NZ_CP098149:358036-358404 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246710 WP_004174006.1 NZ_CP098149:357818-358039 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References