Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2905412..2906101 | Replicon | chromosome |
Accession | NZ_CP098145 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0020 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | NBY48_RS14035 | Protein ID | WP_021469727.1 |
Coordinates | 2905784..2906101 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | NBY48_RS14030 | Protein ID | WP_020804705.1 |
Coordinates | 2905412..2905708 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY48_RS14015 (2901804) | 2901804..2903186 | + | 1383 | WP_004151222.1 | MFS transporter | - |
NBY48_RS14020 (2903230) | 2903230..2904846 | + | 1617 | WP_004175961.1 | carbohydrate porin | - |
NBY48_RS14025 (2904887) | 2904887..2905333 | - | 447 | WP_032435212.1 | hypothetical protein | - |
NBY48_RS14030 (2905412) | 2905412..2905708 | - | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
NBY48_RS14035 (2905784) | 2905784..2906101 | - | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY48_RS14040 (2906308) | 2906308..2906535 | - | 228 | WP_002906690.1 | tautomerase PptA | - |
NBY48_RS14045 (2906606) | 2906606..2907223 | - | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
NBY48_RS14050 (2907301) | 2907301..2908152 | - | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
NBY48_RS14055 (2908191) | 2908191..2908970 | - | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
NBY48_RS14060 (2908954) | 2908954..2909880 | - | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
NBY48_RS14065 (2909890) | 2909890..2910399 | - | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T246699 WP_021469727.1 NZ_CP098145:c2906101-2905784 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |