Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 306661..307307 | Replicon | chromosome |
| Accession | NZ_CP098141 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0025 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4S7KZ03 |
| Locus tag | NBY50_RS02805 | Protein ID | WP_032433636.1 |
| Coordinates | 306661..307008 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4S7L580 |
| Locus tag | NBY50_RS02810 | Protein ID | WP_019725405.1 |
| Coordinates | 307008..307307 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY50_RS02795 (302587) | 302587..304020 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
| NBY50_RS02800 (304038) | 304038..306485 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
| NBY50_RS02805 (306661) | 306661..307008 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY50_RS02810 (307008) | 307008..307307 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
| NBY50_RS02815 (307370) | 307370..308878 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
| NBY50_RS02820 (309083) | 309083..309412 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| NBY50_RS02825 (309463) | 309463..310293 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| NBY50_RS02830 (310343) | 310343..311101 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T246678 WP_032433636.1 NZ_CP098141:306661-307008 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7KZ03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7L580 |