246677

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 280474..281060 Replicon chromosome
Accession NZ_CP098141
Organism Klebsiella pneumoniae strain Z0117KP0025

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY50_RS02695 Protein ID WP_002920800.1
Coordinates 280692..281060 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY50_RS02690 Protein ID WP_004174006.1
Coordinates 280474..280695 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY50_RS02670 (276631) 276631..277557 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NBY50_RS02675 (277554) 277554..278831 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY50_RS02680 (278828) 278828..279595 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY50_RS02685 (279597) 279597..280310 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY50_RS02690 (280474) 280474..280695 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY50_RS02695 (280692) 280692..281060 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY50_RS02700 (281333) 281333..282649 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY50_RS02705 (282756) 282756..283643 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY50_RS02710 (283640) 283640..284485 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY50_RS02715 (284487) 284487..285557 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 277554..286294 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246677 WP_002920800.1 NZ_CP098141:280692-281060 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246677 WP_004174006.1 NZ_CP098141:280474-280695 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References