246665

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3553554..3554140 Replicon chromosome
Accession NZ_CP098136
Organism Klebsiella pneumoniae strain Z0117KP0027

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY52_RS18645 Protein ID WP_002920800.1
Coordinates 3553772..3554140 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY52_RS18640 Protein ID WP_004174006.1
Coordinates 3553554..3553775 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY52_RS18620 (3549711) 3549711..3550637 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NBY52_RS18625 (3550634) 3550634..3551911 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY52_RS18630 (3551908) 3551908..3552675 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY52_RS18635 (3552677) 3552677..3553390 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY52_RS18640 (3553554) 3553554..3553775 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY52_RS18645 (3553772) 3553772..3554140 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY52_RS18650 (3554413) 3554413..3555729 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY52_RS18655 (3555836) 3555836..3556723 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY52_RS18660 (3556720) 3556720..3557565 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY52_RS18665 (3557567) 3557567..3558637 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3550634..3559374 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246665 WP_002920800.1 NZ_CP098136:3553772-3554140 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246665 WP_004174006.1 NZ_CP098136:3553554-3553775 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References