Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2513824..2514470 | Replicon | chromosome |
Accession | NZ_CP098131 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0028 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4S7KZ03 |
Locus tag | NBY54_RS11930 | Protein ID | WP_032433636.1 |
Coordinates | 2513824..2514171 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4S7L580 |
Locus tag | NBY54_RS11935 | Protein ID | WP_019725405.1 |
Coordinates | 2514171..2514470 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY54_RS11920 (2509750) | 2509750..2511183 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
NBY54_RS11925 (2511201) | 2511201..2513648 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
NBY54_RS11930 (2513824) | 2513824..2514171 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY54_RS11935 (2514171) | 2514171..2514470 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
NBY54_RS11940 (2514533) | 2514533..2516041 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
NBY54_RS11945 (2516246) | 2516246..2516575 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
NBY54_RS11950 (2516626) | 2516626..2517456 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
NBY54_RS11955 (2517506) | 2517506..2518264 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T246644 WP_032433636.1 NZ_CP098131:2513824-2514171 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7KZ03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7L580 |