Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 2487637..2488223 Replicon chromosome
Accession NZ_CP098131
Organism Klebsiella pneumoniae strain Z0117KP0028

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY54_RS11820 Protein ID WP_002920800.1
Coordinates 2487855..2488223 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY54_RS11815 Protein ID WP_004174006.1
Coordinates 2487637..2487858 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY54_RS11795 (2483794) 2483794..2484720 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NBY54_RS11800 (2484717) 2484717..2485994 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY54_RS11805 (2485991) 2485991..2486758 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY54_RS11810 (2486760) 2486760..2487473 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY54_RS11815 (2487637) 2487637..2487858 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY54_RS11820 (2487855) 2487855..2488223 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY54_RS11825 (2488496) 2488496..2489812 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY54_RS11830 (2489919) 2489919..2490806 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY54_RS11835 (2490803) 2490803..2491648 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY54_RS11840 (2491650) 2491650..2492720 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 2484717..2493457 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246643 WP_002920800.1 NZ_CP098131:2487855-2488223 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246643 WP_004174006.1 NZ_CP098131:2487637-2487858 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References