Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4901049..4901635 Replicon chromosome
Accession NZ_CP098128
Organism Klebsiella pneumoniae strain Z0117KP0033

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NBY56_RS25425 Protein ID WP_002920800.1
Coordinates 4901049..4901417 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NBY56_RS25430 Protein ID WP_004174006.1
Coordinates 4901414..4901635 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY56_RS25405 (4896552) 4896552..4897622 - 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
NBY56_RS25410 (4897624) 4897624..4898469 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NBY56_RS25415 (4898466) 4898466..4899353 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NBY56_RS25420 (4899460) 4899460..4900776 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NBY56_RS25425 (4901049) 4901049..4901417 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY56_RS25430 (4901414) 4901414..4901635 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY56_RS25435 (4901799) 4901799..4902512 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NBY56_RS25440 (4902514) 4902514..4903281 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NBY56_RS25445 (4903278) 4903278..4904555 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NBY56_RS25450 (4904552) 4904552..4905478 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4895815..4904555 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T246636 WP_002920800.1 NZ_CP098128:c4901417-4901049 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT246636 WP_004174006.1 NZ_CP098128:c4901635-4901414 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References