Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 101522..102179 Replicon plasmid p18001477_NDM
Accession NZ_CP098041
Organism Providencia rettgeri strain 18004577

Toxin (Protein)


Gene name higB Uniprot ID A0A857SB97
Locus tag L3Q80_RS22355 Protein ID WP_042847389.1
Coordinates 101829..102179 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag L3Q80_RS22350 Protein ID WP_282562008.1
Coordinates 101522..101827 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L3Q80_RS22315 (L3Q80_22305) 97837..98046 + 210 WP_042847397.1 hypothetical protein -
L3Q80_RS22320 (L3Q80_22310) 98123..98437 + 315 WP_042847396.1 hypothetical protein -
L3Q80_RS22330 (L3Q80_22320) 98711..98929 + 219 WP_042847394.1 hypothetical protein -
L3Q80_RS22335 (L3Q80_22325) 98963..99487 + 525 WP_052219403.1 hypothetical protein -
L3Q80_RS22340 (L3Q80_22330) 99919..100353 + 435 WP_282562006.1 hypothetical protein -
L3Q80_RS22345 (L3Q80_22335) 100362..101387 - 1026 WP_282562007.1 hypothetical protein -
L3Q80_RS22350 (L3Q80_22340) 101522..101827 - 306 WP_282562008.1 helix-turn-helix domain-containing protein Antitoxin
L3Q80_RS22355 (L3Q80_22345) 101829..102179 - 351 WP_042847389.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
L3Q80_RS22360 (L3Q80_22350) 102364..102927 + 564 WP_042847388.1 recombinase family protein -
L3Q80_RS22365 (L3Q80_22355) 103058..103405 + 348 WP_042847387.1 hypothetical protein -
L3Q80_RS22370 (L3Q80_22360) 103684..104010 + 327 WP_042847386.1 PerC family transcriptional regulator -
L3Q80_RS22375 (L3Q80_22365) 104099..104488 + 390 WP_042847385.1 hypothetical protein -
L3Q80_RS22380 (L3Q80_22370) 104517..105221 + 705 WP_042847384.1 hypothetical protein -
L3Q80_RS22385 (L3Q80_22375) 105236..105775 + 540 WP_042847383.1 hypothetical protein -
L3Q80_RS22390 (L3Q80_22380) 105839..106429 + 591 WP_166268309.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / qacE / sul1 / blaPER-4 / aph(3')-VI / blaNDM-1 / catA1 - 1..273271 273271
- flank IS/Tn - - 102364..102927 563


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-107)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-84)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13437.50 Da        Isoelectric Point: 5.2661

>T246602 WP_042847389.1 NZ_CP098041:c102179-101829 [Providencia rettgeri]
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYAAHLLEQEK

Download         Length: 351 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11061.78 Da        Isoelectric Point: 7.0171

>AT246602 WP_282562008.1 NZ_CP098041:c101827-101522 [Providencia rettgeri]
MSTLNELLAKQSPETLAKIEDRAEEIRREITLAKIREELKLSQTELAQSLGVSQPSIAKLENVDNDPKLSTLKRYIKALG
GELSIDVTLPNGKRIGLHLA

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A857SB97

Antitoxin

Source ID Structure

References