Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4568851..4569479 | Replicon | chromosome |
Accession | NZ_CP098030 | ||
Organism | Serratia ureilytica strain HNU47 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NAL25_RS21775 | Protein ID | WP_046897263.1 |
Coordinates | 4568851..4569141 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8B4GQY7 |
Locus tag | NAL25_RS21780 | Protein ID | WP_015379150.1 |
Coordinates | 4569156..4569479 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAL25_RS21765 (NAL25_21740) | 4565426..4567447 | + | 2022 | WP_046897265.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NAL25_RS21770 (NAL25_21745) | 4567482..4568621 | - | 1140 | WP_016930173.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NAL25_RS21775 (NAL25_21750) | 4568851..4569141 | + | 291 | WP_046897263.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NAL25_RS21780 (NAL25_21755) | 4569156..4569479 | + | 324 | WP_015379150.1 | HigA family addiction module antitoxin | Antitoxin |
NAL25_RS21785 (NAL25_21760) | 4569472..4569984 | + | 513 | WP_042785417.1 | M48 family metallopeptidase | - |
NAL25_RS21790 (NAL25_21765) | 4570035..4571015 | + | 981 | WP_075685009.1 | Gfo/Idh/MocA family oxidoreductase | - |
NAL25_RS21795 (NAL25_21770) | 4571017..4571748 | + | 732 | WP_193550128.1 | glutamine amidotransferase | - |
NAL25_RS21800 (NAL25_21775) | 4572004..4572969 | + | 966 | WP_193550146.1 | TerC family protein | - |
NAL25_RS21805 (NAL25_21780) | 4573232..4574467 | + | 1236 | WP_193550129.1 | serine/threonine transporter SstT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11733.43 Da Isoelectric Point: 10.3320
>T246585 WP_046897263.1 NZ_CP098030:4568851-4569141 [Serratia ureilytica]
MIKSFRDRYLEQFYLEGRRSRLIPGMLERQLARKLDMLAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAERIYLDPHQDT
MIKSFRDRYLEQFYLEGRRSRLIPGMLERQLARKLDMLAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAERIYLDPHQDT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|