Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 557213..557866 | Replicon | chromosome |
| Accession | NZ_CP098030 | ||
| Organism | Serratia ureilytica strain HNU47 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NAL25_RS02580 | Protein ID | WP_033645671.1 |
| Coordinates | 557213..557563 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A5P6GPL8 |
| Locus tag | NAL25_RS02585 | Protein ID | WP_047572825.1 |
| Coordinates | 557567..557866 (+) | Length | 100 a.a. |
Genomic Context
Location: 554409..554726 (318 bp)
Type: Others
Protein ID: WP_033638833.1
Type: Others
Protein ID: WP_033638833.1
Location: 557213..557563 (351 bp)
Type: Toxin
Protein ID: WP_033645671.1
Type: Toxin
Protein ID: WP_033645671.1
Location: 557567..557866 (300 bp)
Type: Antitoxin
Protein ID: WP_047572825.1
Type: Antitoxin
Protein ID: WP_047572825.1
Location: 558942..559640 (699 bp)
Type: Others
Protein ID: WP_004933280.1
Type: Others
Protein ID: WP_004933280.1
Location: 559652..560305 (654 bp)
Type: Others
Protein ID: WP_257712625.1
Type: Others
Protein ID: WP_257712625.1
Location: 560320..561504 (1185 bp)
Type: Others
Protein ID: WP_257712626.1
Type: Others
Protein ID: WP_257712626.1
Location: 561523..562446 (924 bp)
Type: Others
Protein ID: WP_257712627.1
Type: Others
Protein ID: WP_257712627.1
Location: 552359..552763 (405 bp)
Type: Others
Protein ID: WP_257712623.1
Type: Others
Protein ID: WP_257712623.1
Location: 552802..554172 (1371 bp)
Type: Others
Protein ID: WP_182265230.1
Type: Others
Protein ID: WP_182265230.1
Location: 554717..555112 (396 bp)
Type: Others
Protein ID: WP_046898031.1
Type: Others
Protein ID: WP_046898031.1
Location: 555126..555518 (393 bp)
Type: Others
Protein ID: WP_046898032.1
Type: Others
Protein ID: WP_046898032.1
Location: 555546..555935 (390 bp)
Type: Others
Protein ID: WP_072626664.1
Type: Others
Protein ID: WP_072626664.1
Location: 555935..556940 (1006 bp)
Type: Others
Protein ID: Protein_486
Type: Others
Protein ID: Protein_486
Location: 557856..558773 (918 bp)
Type: Others
Protein ID: WP_257712624.1
Type: Others
Protein ID: WP_257712624.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NAL25_RS02545 (NAL25_02540) | 552359..552763 | - | 405 | WP_257712623.1 | GNAT family N-acetyltransferase | - |
| NAL25_RS02550 (NAL25_02545) | 552802..554172 | - | 1371 | WP_182265230.1 | glutamine synthetase family protein | - |
| NAL25_RS02555 (NAL25_02550) | 554409..554726 | + | 318 | WP_033638833.1 | hypothetical protein | - |
| NAL25_RS02560 (NAL25_02555) | 554717..555112 | - | 396 | WP_046898031.1 | hypothetical protein | - |
| NAL25_RS02565 (NAL25_02560) | 555126..555518 | - | 393 | WP_046898032.1 | hypothetical protein | - |
| NAL25_RS02570 (NAL25_02565) | 555546..555935 | - | 390 | WP_072626664.1 | hypothetical protein | - |
| NAL25_RS02575 (NAL25_02570) | 555935..556940 | - | 1006 | Protein_486 | hypothetical protein | - |
| NAL25_RS02580 (NAL25_02575) | 557213..557563 | + | 351 | WP_033645671.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NAL25_RS02585 (NAL25_02580) | 557567..557866 | + | 300 | WP_047572825.1 | XRE family transcriptional regulator | Antitoxin |
| NAL25_RS02590 (NAL25_02585) | 557856..558773 | - | 918 | WP_257712624.1 | LysR family transcriptional regulator | - |
| NAL25_RS02595 (NAL25_02590) | 558942..559640 | + | 699 | WP_004933280.1 | CoA transferase subunit A | - |
| NAL25_RS02600 (NAL25_02595) | 559652..560305 | + | 654 | WP_257712625.1 | CoA transferase subunit B | - |
| NAL25_RS02605 (NAL25_02600) | 560320..561504 | + | 1185 | WP_257712626.1 | acetyl-CoA C-acetyltransferase | - |
| NAL25_RS02610 (NAL25_02605) | 561523..562446 | + | 924 | WP_257712627.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13546.81 Da Isoelectric Point: 8.2699
>T246571 WP_033645671.1 NZ_CP098030:557213-557563 [Serratia ureilytica]
MWTVMTTEEFDRWLCEQDESTQEKVLAALVMLERAGPSLRRPFVDVLKGSLHPNMKELRIQHKGRPIRAFFAFDPARQAI
VLCAGDKTGNEKRFYKVMLPIADAQFTQYLMCYFKE
MWTVMTTEEFDRWLCEQDESTQEKVLAALVMLERAGPSLRRPFVDVLKGSLHPNMKELRIQHKGRPIRAFFAFDPARQAI
VLCAGDKTGNEKRFYKVMLPIADAQFTQYLMCYFKE
Download Length: 351 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| No matching records found | ||
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5P6GPL8 |