Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-ratA/Fst(toxin) |
Location | 20087..20328 | Replicon | plasmid pQZ076-3 |
Accession | NZ_CP098028 | ||
Organism | Enterococcus faecalis strain QZ076 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | NAG05_RS15525 | Protein ID | WP_002360667.1 |
Coordinates | 20087..20197 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 20237..20328 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG05_RS15485 (15168) | 15168..15398 | - | 231 | WP_002362431.1 | hypothetical protein | - |
NAG05_RS15490 (15602) | 15602..16222 | + | 621 | WP_162500025.1 | recombinase family protein | - |
NAG05_RS15495 (16239) | 16239..16403 | + | 165 | WP_250652966.1 | hypothetical protein | - |
NAG05_RS15505 (17807) | 17807..18040 | + | 234 | WP_002394799.1 | hypothetical protein | - |
NAG05_RS15510 (18200) | 18200..18454 | - | 255 | WP_002394800.1 | hypothetical protein | - |
NAG05_RS15515 (18571) | 18571..19239 | - | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
NAG05_RS15520 (19275) | 19275..19592 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
NAG05_RS15525 (20087) | 20087..20197 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- (20237) | 20237..20328 | - | 92 | NuclAT_0 | - | Antitoxin |
- (20237) | 20237..20328 | - | 92 | NuclAT_0 | - | Antitoxin |
- (20237) | 20237..20328 | - | 92 | NuclAT_0 | - | Antitoxin |
- (20237) | 20237..20328 | - | 92 | NuclAT_0 | - | Antitoxin |
NAG05_RS15530 (20437) | 20437..20736 | + | 300 | WP_010817802.1 | hypothetical protein | - |
NAG05_RS15535 (21521) | 21521..22063 | - | 543 | WP_086321354.1 | hypothetical protein | - |
NAG05_RS15540 (22073) | 22073..22924 | - | 852 | WP_002362419.1 | ParA family protein | - |
NAG05_RS15545 (23587) | 23587..24603 | + | 1017 | WP_033593833.1 | replication initiator protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrG / aph(3')-III / erm(B) | - | 1..55867 | 55867 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T246564 WP_002360667.1 NZ_CP098028:20087-20197 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 92 bp
>AT246564 NZ_CP098028:c20328-20237 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|