Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 375537..375731 | Replicon | chromosome |
Accession | NZ_CP098025 | ||
Organism | Enterococcus faecalis strain QZ076 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | NAG05_RS02020 | Protein ID | WP_015543884.1 |
Coordinates | 375636..375731 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 375537..375601 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG05_RS02005 (371170) | 371170..372912 | + | 1743 | WP_010709199.1 | PTS transporter subunit EIIC | - |
NAG05_RS02010 (372903) | 372903..374936 | + | 2034 | WP_002361171.1 | PRD domain-containing protein | - |
NAG05_RS02015 (374947) | 374947..375381 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (375537) | 375537..375601 | + | 65 | NuclAT_9 | - | Antitoxin |
NAG05_RS02020 (375636) | 375636..375731 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
NAG05_RS02025 (375977) | 375977..377749 | + | 1773 | WP_002389635.1 | PTS mannitol-specific transporter subunit IIBC | - |
NAG05_RS02030 (377764) | 377764..378201 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
NAG05_RS02035 (378216) | 378216..379370 | + | 1155 | WP_010709200.1 | mannitol-1-phosphate 5-dehydrogenase | - |
NAG05_RS02040 (379439) | 379439..380554 | - | 1116 | WP_010709201.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T246543 WP_015543884.1 NZ_CP098025:c375731-375636 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT246543 NZ_CP098025:375537-375601 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|