Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 2404511..2405013 | Replicon | chromosome |
Accession | NZ_CP097884 | ||
Organism | Escherichia coli str. K-12 substr. MG1655 strain K-12 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | U9YDH0 |
Locus tag | NAG72_RS11380 | Protein ID | WP_000767829.1 |
Coordinates | 2404759..2405013 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | S1Q063 |
Locus tag | NAG72_RS11375 | Protein ID | WP_001259255.1 |
Coordinates | 2404511..2404762 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NAG72_RS11350 (2399689) | 2399689..2400756 | - | 1068 | WP_000080105.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
NAG72_RS11355 (2400756) | 2400756..2401826 | - | 1071 | WP_000108941.1 | histidinol-phosphate transaminase | - |
NAG72_RS11360 (2401823) | 2401823..2403127 | - | 1305 | WP_000009594.1 | histidinol dehydrogenase | - |
NAG72_RS11365 (2403133) | 2403133..2404032 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
NAG72_RS11370 (2404178) | 2404178..2404228 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
NAG72_RS11375 (2404511) | 2404511..2404762 | + | 252 | WP_001259255.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
NAG72_RS11380 (2404759) | 2404759..2405013 | + | 255 | WP_000767829.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
NAG72_RS11385 (2405096) | 2405096..2405920 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
NAG72_RS11390 (2405966) | 2405966..2406895 | + | 930 | WP_000803351.1 | LysR substrate-binding domain-containing protein | - |
NAG72_RS11395 (2407110) | 2407110..2407172 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
NAG72_RS11400 (2407162) | 2407162..2408520 | + | 1359 | WP_000019197.1 | putrescine/proton symporter PlaP | - |
NAG72_RS11405 (2408699) | 2408699..2409757 | + | 1059 | WP_000492339.1 | thiosulfate utilization transporter TsuA/YeeE | - |
NAG72_RS11410 (2409771) | 2409771..2409998 | + | 228 | WP_000234896.1 | sulfurtransferase TusA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10183.58 Da Isoelectric Point: 8.0353
>T246494 WP_000767829.1 NZ_CP097884:2404759-2405013 [Escherichia coli str. K-12 substr. MG1655]
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHRLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|